If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

North sea shrimp Protein: Cra c 4 | Sarcoplasmic Calcium-Binding Protein

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 193 amino acids

MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV

UniProt: D7F1P9   IUIS: Cra c 4

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1 Peptide 2 Exp.3 ESP4 CONSeQ5
^ MAYTWDNR V 0 0.311 0.13156
R YMYDIDNNGFLDK N 0 0.544 0.2747
K NDFECLAVK N 0 0.394 0.50412
K NTLIECR G 0 0.278 0.27232
R GEWSAEK Y 0 0.21 0.04836
K IMSNLWNEIAELADFNK D 0 0.521 0.09748
K DGEVTVEEFK Q 0 0.363 0.62504
K HCNGKPFGDFPSAFK T 0 0.356 0.32758
K TFIANQFK T 0 0.341 0.37022
K TIDVNGDGLVGVDEYR L 0 0.586 0.53798
R SAFSCIK E 0 0.26 0.2417
K EIDDAYNLLCTEEDK K 0 0.632 0.45944
K AGGINIAR Y 0 0.295 0.52444
R YQELYAQFISNPDEK C 0 0.719 0.38546
K CNAVYLFGPLK E 0 0.509 0.2995

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.