Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
North sea shrimp Protein: Cra c 4 | Sarcoplasmic Calcium-Binding Protein
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 193 amino acids
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
UniProt: D7F1P9 IUIS: Cra c 4Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MAYTWDNR | V | 0 | 0.311 | 0.13156 |
| R | YMYDIDNNGFLDK | N | 0 | 0.544 | 0.2747 |
| K | NDFECLAVK | N | 0 | 0.394 | 0.50412 |
| K | NTLIECR | G | 0 | 0.278 | 0.27232 |
| R | GEWSAEK | Y | 0 | 0.21 | 0.04836 |
| K | IMSNLWNEIAELADFNK | D | 0 | 0.521 | 0.09748 |
| K | DGEVTVEEFK | Q | 0 | 0.363 | 0.62504 |
| K | HCNGKPFGDFPSAFK | T | 0 | 0.356 | 0.32758 |
| K | TFIANQFK | T | 0 | 0.341 | 0.37022 |
| K | TIDVNGDGLVGVDEYR | L | 0 | 0.586 | 0.53798 |
| R | SAFSCIK | E | 0 | 0.26 | 0.2417 |
| K | EIDDAYNLLCTEEDK | K | 0 | 0.632 | 0.45944 |
| K | AGGINIAR | Y | 0 | 0.295 | 0.52444 |
| R | YQELYAQFISNPDEK | C | 0 | 0.719 | 0.38546 |
| K | CNAVYLFGPLK | E | 0 | 0.509 | 0.2995 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.